PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012568384.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MIKC_MADS
Protein Properties Length: 222aa    MW: 25364.3 Da    PI: 9.8012
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012568384.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.41.9e-28958150
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    k+i+n + rqvtfskRr gi+KKAeELSvLCdaev +iifs tgklyey 
  XP_012568384.1  9 KKIDNATARQVTFSKRRRGIFKKAEELSVLCDAEVGLIIFSATGKLYEYG 58
                    68***********************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.4E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.053161IPR002100Transcription factor, MADS-box
CDDcd002653.36E-37275No hitNo description
SuperFamilySSF554551.57E-30378IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-26323IPR002100Transcription factor, MADS-box
PfamPF003194.6E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-263859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129710.7288178IPR002487Transcription factor, K-box
PfamPF014861.5E-1395172IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MARQKIKIKK IDNATARQVT FSKRRRGIFK KAEELSVLCD AEVGLIIFSA TGKLYEYGSS  60
KYVRMKDIIT RYNQHFQHMS KSNKPLQEFQ GENLSAELQK EVADKTQQLR GMKGEDFEGI  120
NLKGLQELEK TLETGLKRVM EMKEKRIVNE ISTLQIKGIK LEEQNKHLKQ KMAMLCNRKN  180
LILGDSDITM QEIVSSESMN NSGLSLEDDS SDTSLKLGLP YP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S2e-17188186Myocyte-specific enhancer factor 2B
1tqe_R2e-17188186Myocyte-specific enhancer factor 2B
1tqe_Q2e-17188186Myocyte-specific enhancer factor 2B
1tqe_P2e-17188186Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012568382.11e-162PREDICTED: MADS-box protein AGL24-like isoform X1
RefseqXP_012568383.11e-162PREDICTED: MADS-box protein AGL24-like isoform X1
RefseqXP_012568384.11e-162PREDICTED: MADS-box protein AGL24-like isoform X1
SwissprotO827943e-69AGL24_ARATH; MADS-box protein AGL24
SwissprotQ9FVC13e-69SVP_ARATH; MADS-box protein SVP
TrEMBLG7KBL21e-115G7KBL2_MEDTR; MADS-box transcription factor
STRINGVIT_18s0001g07460.t016e-77(Vitis vinifera)
STRINGGLYMA06G10020.26e-78(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.16e-63MIKC_MADS family protein